Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Response regulator PleD, receiver domain [117472] (1 species) duplication: tandem repeat of 2 CheY-like domains |
Species Caulobacter crescentus [TaxId:155892] [117473] (2 PDB entries) Uniprot Q9A5I5 |
Domain d2v0na1: 2v0n A:2-140 [152365] Other proteins in same PDB: d2v0na3, d2v0na4, d2v0nb3, d2v0nb4 automated match to d1w25a1 complexed with bef, c2e, cl, gav, mg, so4 |
PDB Entry: 2v0n (more details), 2.71 Å
SCOPe Domain Sequences for d2v0na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v0na1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr fklvidelrqreasgrrmg
Timeline for d2v0na1:
View in 3D Domains from other chains: (mouse over for more information) d2v0nb1, d2v0nb2, d2v0nb3, d2v0nb4 |