Lineage for d2v00a1 (2v00 A:1-330)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 804499Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 804683Protein Endothiapepsin [50647] (1 species)
  7. 804684Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (36 PDB entries)
  8. 804693Domain d2v00a1: 2v00 A:1-330 [152359]
    automatically matched to d1e5oe_
    complexed with act, gol, v15

Details for d2v00a1

PDB Entry: 2v00 (more details), 1.55 Å

PDB Description: x-ray crystal structure of endothiapepsin complexed with compound 1
PDB Compounds: (A:) endothiapepsin

SCOP Domain Sequences for d2v00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v00a1 b.50.1.2 (A:1-330) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOP Domain Coordinates for d2v00a1:

Click to download the PDB-style file with coordinates for d2v00a1.
(The format of our PDB-style files is described here.)

Timeline for d2v00a1: