SCOP 1.75: Domain d2uzqf1: 2uzq F:377-545

Lineage for d2uzqf1 (2uzq F:377-545)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (4 proteins)

6. Protein CDC25b [52825] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52826] (10 PDB entries)

8. Domain d2uzqf1: 2uzq F:377-545 [152358]
   automatically matched to d1cwsa_
   complexed with po4

Details for d2uzqf1

PDB Entry: 2uzq, 2.38 Å

PDB Description: Protein Phosphatase, New Crystal Form

PDB Compounds: (F:) M-phase inducer phosphatase 2

SCOP Domain Sequences for d2uzqf1:

Sequence; same for both SEQRES and ATOM records:

>d2uzqf1 c.46.1.1 (F:377-545) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
eligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyeggh
iktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravnd
ypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrl

Timeline for d2uzqf1:

• d2uzqf1 is new in SCOP 1.75
  
• d2uzqf1 is called d2uzqf_ in SCOPe 2.01
  
• d2uzqf1 appears in the current release, SCOPe 2.08, called d2uzqf2