| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
| Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins) |
| Protein automated matches [190157] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186879] (1 PDB entry) |
| Domain d2uzqd2: 2uzq D:376-545 [152356] Other proteins in same PDB: d2uzqa3, d2uzqb3, d2uzqc3, d2uzqd3, d2uzqe3, d2uzqf3 automated match to d1cwra_ complexed with po4 |
PDB Entry: 2uzq (more details), 2.38 Å
SCOPe Domain Sequences for d2uzqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzqd2 c.46.1.1 (D:376-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravn
dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrl
Timeline for d2uzqd2: