Lineage for d2uzqb2 (2uzq B:376-545)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131497Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2131498Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2131499Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)
  6. 2131525Protein automated matches [190157] (1 species)
    not a true protein
  7. 2131526Species Human (Homo sapiens) [TaxId:9606] [186879] (1 PDB entry)
  8. 2131528Domain d2uzqb2: 2uzq B:376-545 [152354]
    Other proteins in same PDB: d2uzqa3, d2uzqb3, d2uzqc3, d2uzqd3, d2uzqe3, d2uzqf3
    automated match to d1cwra_
    complexed with po4

Details for d2uzqb2

PDB Entry: 2uzq (more details), 2.38 Å

PDB Description: Protein Phosphatase, New Crystal Form
PDB Compounds: (B:) M-phase inducer phosphatase 2

SCOPe Domain Sequences for d2uzqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzqb2 c.46.1.1 (B:376-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravn
dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrl

SCOPe Domain Coordinates for d2uzqb2:

Click to download the PDB-style file with coordinates for d2uzqb2.
(The format of our PDB-style files is described here.)

Timeline for d2uzqb2: