SCOPe 2.08: Domain d2uzqb2: 2uzq B:376-545

Lineage for d2uzqb2 (2uzq B:376-545)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)

6. Protein automated matches [190157] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186879] (1 PDB entry)

8. Domain d2uzqb2: 2uzq B:376-545 [152354]
   Other proteins in same PDB: d2uzqa3, d2uzqb3, d2uzqc3, d2uzqd3, d2uzqe3, d2uzqf3
   automated match to d1cwra_
   complexed with po4

Details for d2uzqb2

PDB Entry: 2uzq, 2.38 Å

PDB Description: Protein Phosphatase, New Crystal Form

PDB Compounds: (B:) M-phase inducer phosphatase 2

SCOPe Domain Sequences for d2uzqb2:

Sequence; same for both SEQRES and ATOM records:

>d2uzqb2 c.46.1.1 (B:376-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravn
dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrl

Timeline for d2uzqb2:

• d2uzqb2 first appeared in SCOP 1.75, called d2uzqb1
  
• d2uzqb2 appears in SCOPe 2.07