Lineage for d2uzld2 (2uzl D:310-432)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1273884Protein Cyclin A [47956] (2 species)
  7. 1273920Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries)
    Uniprot P20248 175-432
  8. 1274054Domain d2uzld2: 2uzl D:310-432 [152352]
    Other proteins in same PDB: d2uzla_, d2uzlc_
    automated match to d1h1pb2
    complexed with c94

Details for d2uzld2

PDB Entry: 2uzl (more details), 2.4 Å

PDB Description: crystal structure of human cdk2 complexed with a thiazolidinone inhibitor
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2uzld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzld2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d2uzld2:

Click to download the PDB-style file with coordinates for d2uzld2.
(The format of our PDB-style files is described here.)

Timeline for d2uzld2: