SCOPe 2.04: Domain d2uzlb2: 2uzl B:310-432

Lineage for d2uzlb2 (2uzl B:310-432)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
   Uniprot P20248 175-432

8. Domain d2uzlb2: 2uzl B:310-432 [152350]
   Other proteins in same PDB: d2uzla_, d2uzlc_
   automated match to d1h1pb2
   complexed with c94

Details for d2uzlb2

PDB Entry: 2uzl, 2.4 Å

PDB Description: crystal structure of human cdk2 complexed with a thiazolidinone inhibitor

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2uzlb2:

Sequence; same for both SEQRES and ATOM records:

>d2uzlb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d2uzlb2:

• d2uzlb2 first appeared in SCOP 1.75
  
• d2uzlb2 appears in SCOPe 2.03
  
• d2uzlb2 appears in SCOPe 2.05
  
• d2uzlb2 appears in the current release, SCOPe 2.08