SCOP 1.75: Domain d2uzir1: 2uzi R:1-166

Lineage for d2uzir1 (2uzi R:1-166)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (56 PDB entries)
   Uniprot Q6P716

8. Domain d2uzir1: 2uzi R:1-166 [152348]
   automatically matched to d2q21a_
   complexed with gtp, mg, zn; mutant

Details for d2uzir1

PDB Entry: 2uzi, 2 Å

PDB Description: crystal structure of hras(g12v) - anti-ras fv complex

PDB Compounds: (R:) gtpase hras

SCOP Domain Sequences for d2uzir1:

Sequence; same for both SEQRES and ATOM records:

>d2uzir1 c.37.1.8 (R:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d2uzir1:

• d2uzir1 is new in SCOP 1.75
  
• d2uzir1 is called d2uzir_ in SCOPe 2.01
  
• d2uzir1 appears in the current release, SCOPe 2.08, called d2uzir_