![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.5: Zf-UBP [161204] (3 proteins) Pfam PF02148 |
![]() | Protein Ubiquitin carboxyl-terminal hydrolase 33, UBP33 [161209] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161210] (1 PDB entry) Uniprot Q8TEY7 36-130 |
![]() | Domain d2uzga1: 2uzg A:36-130 [152347] complexed with zn |
PDB Entry: 2uzg (more details)
SCOPe Domain Sequences for d2uzga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]} rnhcphldsvgeitkedliqkslgtcqdckvqgpnlwaclenrcsyvgcgesqvdhstih sqetkhyltvnlttlrvwcyacskevfldrklgtq
Timeline for d2uzga1: