Lineage for d2uzga1 (2uzg A:36-130)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037640Family g.44.1.5: Zf-UBP [161204] (4 proteins)
    Pfam PF02148
  6. 3037644Protein Ubiquitin carboxyl-terminal hydrolase 33, UBP33 [161209] (1 species)
  7. 3037645Species Human (Homo sapiens) [TaxId:9606] [161210] (1 PDB entry)
    Uniprot Q8TEY7 36-130
  8. 3037646Domain d2uzga1: 2uzg A:36-130 [152347]
    complexed with zn

Details for d2uzga1

PDB Entry: 2uzg (more details)

PDB Description: zf-ubp domain of vdu1
PDB Compounds: (A:) ubiquitin carboxyl-terminal hydrolase 33

SCOPe Domain Sequences for d2uzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]}
rnhcphldsvgeitkedliqkslgtcqdckvqgpnlwaclenrcsyvgcgesqvdhstih
sqetkhyltvnlttlrvwcyacskevfldrklgtq

SCOPe Domain Coordinates for d2uzga1:

Click to download the PDB-style file with coordinates for d2uzga1.
(The format of our PDB-style files is described here.)

Timeline for d2uzga1: