| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
| Domain d2uzbd1: 2uzb D:175-309 [152337] Other proteins in same PDB: d2uzba_, d2uzbc_ automated match to d1h1pb1 complexed with c75 |
PDB Entry: 2uzb (more details), 2.7 Å
SCOPe Domain Sequences for d2uzbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzbd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap
Timeline for d2uzbd1:
View in 3DDomains from other chains: (mouse over for more information) d2uzba_, d2uzbb1, d2uzbb2, d2uzbc_ |