Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (8 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries) Uniprot P20248 175-432 |
Domain d2uzbb1: 2uzb B:181-308 [152335] Other proteins in same PDB: d2uzba_, d2uzbc_ automatically matched to d1vina1 complexed with c75 |
PDB Entry: 2uzb (more details), 2.7 Å
SCOPe Domain Sequences for d2uzbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzbb1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vltfdlaa
Timeline for d2uzbb1:
View in 3D Domains from other chains: (mouse over for more information) d2uzba_, d2uzbc_, d2uzbd1, d2uzbd2 |