Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries) |
Domain d2uzab5: 2uza B:669-785 [152334] Other proteins in same PDB: d2uzaa1, d2uzaa2, d2uzaa3, d2uzaa4, d2uzab1, d2uzab2, d2uzab3, d2uzab4 automated match to d1keka5 complexed with ca, co2, htl, mg, sf4 |
PDB Entry: 2uza (more details), 2.42 Å
SCOPe Domain Sequences for d2uzab5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzab5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d2uzab5: