SCOPe 2.06: Domain d1d8ua_: 1d8u A:

Lineage for d1d8ua_ (1d8u A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Non-symbiotic plant hemoglobin [46484] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries)

8. Domain d1d8ua_: 1d8u A: [15233]
   complexed with hem

Details for d1d8ua_

PDB Entry: 1d8u, 2.35 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice

PDB Compounds: (A:) non-symbiotic hemoglobin

SCOPe Domain Sequences for d1d8ua_:

Sequence; same for both SEQRES and ATOM records:

>d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae

Timeline for d1d8ua_:

• d1d8ua_ first appeared (with stable ids) in SCOP 1.55
  
• d1d8ua_ appears in SCOPe 2.05
  
• d1d8ua_ appears in SCOPe 2.07
  
• d1d8ua_ appears in the current release, SCOPe 2.08