Lineage for d2uzaa5 (2uza A:669-785)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949358Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 2949359Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries)
  8. 2949376Domain d2uzaa5: 2uza A:669-785 [152329]
    Other proteins in same PDB: d2uzaa1, d2uzaa2, d2uzaa3, d2uzaa4, d2uzab1, d2uzab2, d2uzab3, d2uzab4
    automated match to d1keka5
    complexed with ca, co2, htl, mg, sf4

Details for d2uzaa5

PDB Entry: 2uza (more details), 2.42 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (A:) pyruvate ferredoxin oxidoreductase

SCOPe Domain Sequences for d2uzaa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzaa5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOPe Domain Coordinates for d2uzaa5:

Click to download the PDB-style file with coordinates for d2uzaa5.
(The format of our PDB-style files is described here.)

Timeline for d2uzaa5: