| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.12: PFOR PP module [88771] (1 protein) domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains |
| Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI [88772] (1 species) |
| Species Desulfovibrio africanus [TaxId:873] [88773] (10 PDB entries) |
| Domain d2uzaa2: 2uza A:786-1232 [152326] Other proteins in same PDB: d2uzaa1, d2uzaa3, d2uzaa4, d2uzaa5, d2uzab1, d2uzab3, d2uzab4, d2uzab5 automated match to d1keka2 complexed with ca, co2, htl, mg, sf4 |
PDB Entry: 2uza (more details), 2.42 Å
SCOPe Domain Sequences for d2uzaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzaa2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]}
vksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcssiwg
asapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesdasgd
vkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifggdgw
aydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtgkkdl
armvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmgksqd
vmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsfpeda
krlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtpmmar
pdsgeacdqnragtseqqgdlskrtkk
Timeline for d2uzaa2: