SCOPe 2.06: Domain d2uz9a1: 2uz9 A:8-75,A:389-451

Lineage for d2uz9a1 (2uz9 A:8-75,A:389-451)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)

6. Protein Guanine deaminase [159336] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159338] (2 PDB entries)
   Uniprot Q9Y2T3 8-75,389-451

8. Domain d2uz9a1: 2uz9 A:8-75,A:389-451 [152323]
   Other proteins in same PDB: d2uz9a2
   complexed with xan, zn

Details for d2uz9a1

PDB Entry: 2uz9, 2.3 Å

PDB Description: human guanine deaminase (guad) in complex with zinc and its product xanthine.

PDB Compounds: (A:) guanine deaminase

SCOPe Domain Sequences for d2uz9a1:

Sequence; same for both SEQRES and ATOM records:

>d2uz9a1 b.92.1.4 (A:8-75,A:389-451) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]}
plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire
lshheffmXfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrniee
vyvggkqvvpfs

Timeline for d2uz9a1:

• d2uz9a1 first appeared in SCOP 1.75
  
• d2uz9a1 appears in SCOPe 2.05
  
• d2uz9a1 appears in SCOPe 2.07
  
• d2uz9a1 appears in the current release, SCOPe 2.08