Lineage for d2uyqa_ (2uyq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130511Family c.66.1.57: ML2640-like [159694] (2 protein domains)
    Pfam PF02409; O-methyltransferase N-terminus (DUF142); most similar structure to the Leucine carboxy methyltransferase Ppm1 family
  6. 2130515Protein automated matches [190566] (1 species)
    not a true protein
  7. 2130516Species Mycobacterium leprae [TaxId:1769] [187556] (3 PDB entries)
  8. 2130518Domain d2uyqa_: 2uyq A: [152322]
    automated match to d2ckda1
    complexed with sam

Details for d2uyqa_

PDB Entry: 2uyq (more details), 1.8 Å

PDB Description: crystal structure of ml2640c from mycobacterium leprae in complex with s-adenosylmethionine
PDB Compounds: (A:) hypothetical protein ml2640

SCOPe Domain Sequences for d2uyqa_:

Sequence, based on SEQRES records: (download)

>d2uyqa_ c.66.1.57 (A:) automated matches {Mycobacterium leprae [TaxId: 1769]}
vgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldpsmvakveaidaea
aamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrldwptgttvyeidq
pkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsartawlaegllmylp
ataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsdalgfeqavdvqeli
yhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkdafaefvtahrl

Sequence, based on observed residues (ATOM records): (download)

>d2uyqa_ c.66.1.57 (A:) automated matches {Mycobacterium leprae [TaxId: 1769]}
vgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamdaeaaamvehmrsyqa
vrtnffdtyfnnavidgirqfvilasgldsrayrldwptgttvyeidqpkvlayksttla
ehgvtptadrrevpidlrqdwppalrsagfdpsartawlaegllmylpataqdglfteig
glsavgsriavetsplhgdewreqmqlrfrrvsdaliyhdenravvadwlnrhgwrataq
sapdemrrvgrwgdgvpmaddkdafaefvtahrl

SCOPe Domain Coordinates for d2uyqa_:

Click to download the PDB-style file with coordinates for d2uyqa_.
(The format of our PDB-style files is described here.)

Timeline for d2uyqa_: