![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (432 PDB entries) Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167 |
![]() | Domain d2uy0a_: 2uy0 A: [152315] automated match to d1ajva_ complexed with hv1 |
PDB Entry: 2uy0 (more details), 1.76 Å
SCOPe Domain Sequences for d2uy0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uy0a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d2uy0a_: