Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159954] (8 PDB entries) Uniprot O60341 655-763 |
Domain d2uxxa3: 2uxx A:655-763 [152312] Other proteins in same PDB: d2uxxa1, d2uxxa2 automated match to d2iw5a3 complexed with cl, faj, gol |
PDB Entry: 2uxx (more details), 2.74 Å
SCOPe Domain Sequences for d2uxxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxxa3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy
Timeline for d2uxxa3: