SCOPe 2.04: Domain d2uxxa3: 2uxx A:655-763

Lineage for d2uxxa3 (2uxx A:655-763)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159954] (8 PDB entries)
   Uniprot O60341 655-763

8. Domain d2uxxa3: 2uxx A:655-763 [152312]
   Other proteins in same PDB: d2uxxa1, d2uxxa2
   automated match to d2iw5a3
   complexed with cl, faj, gol

Details for d2uxxa3

PDB Entry: 2uxx, 2.74 Å

PDB Description: human lsd1 histone demethylase-corest in complex with an fad- tranylcypromine adduct

PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2uxxa3:

Sequence; same for both SEQRES and ATOM records:

>d2uxxa3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

Timeline for d2uxxa3:

• d2uxxa3 first appeared in SCOP 1.75
  
• d2uxxa3 appears in SCOPe 2.03
  
• d2uxxa3 appears in SCOPe 2.05
  
• d2uxxa3 appears in the current release, SCOPe 2.08