Lineage for d2uxxa2 (2uxx A:274-654,A:764-835)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154320Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1154402Protein Lysine-specific histone demethylase 1, LSD1 [159432] (1 species)
  7. 1154403Species Human (Homo sapiens) [TaxId:9606] [159433] (8 PDB entries)
    Uniprot O60341 274-654,764-836
  8. 1154409Domain d2uxxa2: 2uxx A:274-654,A:764-835 [152311]
    Other proteins in same PDB: d2uxxa1, d2uxxa3
    automatically matched to 2IW5 A:274-654,A:764-836
    complexed with cl, fa9, gol

Details for d2uxxa2

PDB Entry: 2uxx (more details), 2.74 Å

PDB Description: human lsd1 histone demethylase-corest in complex with an fad- tranylcypromine adduct
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2uxxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxxa2 c.3.1.2 (A:274-654,A:764-835) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
ptkktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamv
vtglggnpmavvskqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsyls
hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlke
kikelhqqykeasevkpprditaeflvkskhrdltalckeydelaetqgkleeklqelea
nppsdvylssrdrqildwhfanlefanatplstlslkhwdqdddfeftgshltvrngysc
vpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqq
ppavqfvpplpewktsavqrmXvaagssgndydlmaqpitpgpsipgapqpiprlffage
htirnypatvhgallsglreagriadqflgamyt

SCOPe Domain Coordinates for d2uxxa2:

Click to download the PDB-style file with coordinates for d2uxxa2.
(The format of our PDB-style files is described here.)

Timeline for d2uxxa2: