Lineage for d2uxxa1 (2uxx A:171-273)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1078588Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1079278Family a.4.1.18: SWIRM domain [140222] (3 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 1079279Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 1079280Species Human (Homo sapiens) [TaxId:9606] [140228] (9 PDB entries)
    Uniprot O60341 169-279
  8. 1079286Domain d2uxxa1: 2uxx A:171-273 [152310]
    Other proteins in same PDB: d2uxxa2, d2uxxa3
    automatically matched to 2IW5 A:171-273
    complexed with cl, fa9, gol

Details for d2uxxa1

PDB Entry: 2uxx (more details), 2.74 Å

PDB Description: human lsd1 histone demethylase-corest in complex with an fad- tranylcypromine adduct
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2uxxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxxa1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOPe Domain Coordinates for d2uxxa1:

Click to download the PDB-style file with coordinates for d2uxxa1.
(The format of our PDB-style files is described here.)

Timeline for d2uxxa1: