Lineage for d1bina_ (1bin A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687826Protein Leghemoglobin [46481] (2 species)
  7. 2687827Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries)
  8. 2687828Domain d1bina_: 1bin A: [15231]
    complexed with act, hem, so4

Details for d1bina_

PDB Entry: 1bin (more details), 2.2 Å

PDB Description: leghemoglobin a (acetomet)
PDB Compounds: (A:) leghemoglobin a

SCOPe Domain Sequences for d1bina_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bina_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka

SCOPe Domain Coordinates for d1bina_:

Click to download the PDB-style file with coordinates for d1bina_.
(The format of our PDB-style files is described here.)

Timeline for d1bina_: