Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries) Uniprot P02954 |
Domain d2uxml1: 2uxm L:1-281 [152308] Other proteins in same PDB: d2uxmm1 automatically matched to d1aigl_ complexed with bcl, bph, fe, gol, hto, lda, po4, spo, u10, uq2 |
PDB Entry: 2uxm (more details), 2.7 Å
SCOP Domain Sequences for d2uxml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxml1 f.26.1.1 (L:1-281) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d2uxml1: