Lineage for d2uxkl_ (2uxk L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027525Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries)
  8. 3027553Domain d2uxkl_: 2uxk L: [152304]
    Other proteins in same PDB: d2uxkh1, d2uxkh2
    automated match to d1aigl_
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uxkl_

PDB Entry: 2uxk (more details), 2.31 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 10 in the charge-separated state
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2uxkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxkl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2uxkl_:

Click to download the PDB-style file with coordinates for d2uxkl_.
(The format of our PDB-style files is described here.)

Timeline for d2uxkl_: