Lineage for d1fslb_ (1fsl B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474648Protein Leghemoglobin [46481] (2 species)
  7. 1474649Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries)
  8. 1474651Domain d1fslb_: 1fsl B: [15230]
    complexed with hem, nio

Details for d1fslb_

PDB Entry: 1fsl (more details), 2.3 Å

PDB Description: ferric soybean leghemoglobin complexed with nicotinate
PDB Compounds: (B:) leghemoglobin a

SCOPe Domain Sequences for d1fslb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fslb_ a.1.1.2 (B:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka

SCOPe Domain Coordinates for d1fslb_:

Click to download the PDB-style file with coordinates for d1fslb_.
(The format of our PDB-style files is described here.)

Timeline for d1fslb_: