| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Leghemoglobin [46481] (2 species) |
| Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries) |
| Domain d1fslb_: 1fsl B: [15230] complexed with hem, nio |
PDB Entry: 1fsl (more details), 2.3 Å
SCOPe Domain Sequences for d1fslb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fslb_ a.1.1.2 (B:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka
Timeline for d1fslb_: