Lineage for d2uxds1 (2uxd S:2-81)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268875Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2268907Domain d2uxds1: 2uxd S:2-81 [152299]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdm1, d2uxdn1, d2uxdq1, d2uxdr1, d2uxdt1, d2uxdv1
    automatically matched to d1ibms_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxds1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (S:) ribosomal protein s19

SCOPe Domain Sequences for d2uxds1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxds1 i.1.1.1 (S:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2uxds1:

Click to download the PDB-style file with coordinates for d2uxds1.
(The format of our PDB-style files is described here.)

Timeline for d2uxds1: