Lineage for d2uxdr1 (2uxd R:19-88)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907572Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 907573Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 907574Protein Ribosomal protein S18 [46913] (2 species)
  7. 907600Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 907620Domain d2uxdr1: 2uxd R:19-88 [152298]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxds1, d2uxdt1, d2uxdv1
    automatically matched to d2j00r1
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxdr1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (R:) ribosomal protein s18

SCOPe Domain Sequences for d2uxdr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxdr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d2uxdr1:

Click to download the PDB-style file with coordinates for d2uxdr1.
(The format of our PDB-style files is described here.)

Timeline for d2uxdr1: