Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
Domain d2uxdr1: 2uxd R:19-88 [152298] Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxds1, d2uxdt1, d2uxdv1 automatically matched to d2j00r1 protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxd (more details), 3.2 Å
SCOPe Domain Sequences for d2uxdr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxdr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl lpfteklvrk
Timeline for d2uxdr1: