Lineage for d2uxdo1 (2uxd O:2-89)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1970701Protein 70S ribosome functional complex [58121] (4 species)
  7. 1971258Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1971288Domain d2uxdo1: 2uxd O:2-89 [152295]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdm1, d2uxdn1, d2uxdq1, d2uxdr1, d2uxdt1, d2uxdv1
    automatically matched to d1eg0f_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxdo1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (O:) ribosomal protein s15

SCOPe Domain Sequences for d2uxdo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxdo1 i.1.1.1 (O:2-89) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2uxdo1:

Click to download the PDB-style file with coordinates for d2uxdo1.
(The format of our PDB-style files is described here.)

Timeline for d2uxdo1: