| Class g: Small proteins [56992] (90 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) ![]() |
| Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
| Protein Ribosomal protein S14 [57753] (2 species) |
| Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries) Uniprot P24320 |
| Domain d2uxdn1: 2uxd N:2-61 [152294] Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1 automatically matched to d1fjgn_ complexed with k, mg, par, zn |
PDB Entry: 2uxd (more details), 3.2 Å
SCOP Domain Sequences for d2uxdn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxdn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d2uxdn1: