Lineage for d2uxdj1 (2uxd J:3-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029014Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 1029015Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1029016Protein Ribosomal protein S10 [55001] (2 species)
  7. 1029042Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 1029062Domain d2uxdj1: 2uxd J:3-100 [152290]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1
    automatically matched to d1fjgj_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxdj1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (J:) ribosomal protein s10

SCOPe Domain Sequences for d2uxdj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxdj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2uxdj1:

Click to download the PDB-style file with coordinates for d2uxdj1.
(The format of our PDB-style files is described here.)

Timeline for d2uxdj1: