| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() |
| Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
| Protein Ribosomal protein S10 [55001] (2 species) |
| Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
| Domain d2uxdj1: 2uxd J:3-100 [152290] Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1 automatically matched to d1fjgj_ complexed with k, mg, par, zn |
PDB Entry: 2uxd (more details), 3.2 Å
SCOP Domain Sequences for d2uxdj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxdj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d2uxdj1: