SCOP 1.71: Domain d1fsla_: 1fsl A:

Lineage for d1fsla_ (1fsl A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Leghemoglobin [46481] (2 species)

7. Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries)

8. Domain d1fsla_: 1fsl A: [15229]

Details for d1fsla_

PDB Entry: 1fsl, 2.3 Å

PDB Description: ferric soybean leghemoglobin complexed with nicotinate

SCOP Domain Sequences for d1fsla_:

Sequence; same for both SEQRES and ATOM records:

>d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka

Timeline for d1fsla_:

• d1fsla_ first appeared (with stable ids) in SCOP 1.55
  
• d1fsla_ appears in SCOP 1.69
  
• d1fsla_ appears in SCOP 1.73
  
• d1fsla_ appears in the current release, SCOPe 2.07