Lineage for d2uxdf1 (2uxd F:1-101)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909830Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1909831Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1909832Protein Ribosomal protein S6 [54997] (4 species)
  7. 1909862Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1909885Domain d2uxdf1: 2uxd F:1-101 [152286]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1
    automatically matched to d1fjgf_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxdf1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (F:) ribosomal protein s6

SCOPe Domain Sequences for d2uxdf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxdf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2uxdf1:

Click to download the PDB-style file with coordinates for d2uxdf1.
(The format of our PDB-style files is described here.)

Timeline for d2uxdf1: