![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() automatically mapped to Pfam PF01649 |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
![]() | Domain d2uxbt1: 2uxb T:8-106 [152281] Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbr1, d2uxbs1, d2uxbu1 automatically matched to d1fjgt_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxb (more details), 3.1 Å
SCOPe Domain Sequences for d2uxbt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxbt1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d2uxbt1: