![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Leghemoglobin [46481] (2 species) |
![]() | Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) |
![]() | Domain d1lh6a_: 1lh6 A: [15228] complexed with hem, nio |
PDB Entry: 1lh6 (more details), 2 Å
SCOPe Domain Sequences for d1lh6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lh6a_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]} galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike vvgakwseelnsawtiaydelaivikkemddaa
Timeline for d1lh6a_: