Lineage for d2uxbn1 (2uxb N:2-61)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244607Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1244608Protein Ribosomal protein S14 [57753] (2 species)
  7. 1244634Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1244662Domain d2uxbn1: 2uxb N:2-61 [152275]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbr1, d2uxbs1, d2uxbt1, d2uxbu1
    automatically matched to d1fjgn_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxbn1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (N:) ribosomal protein s14

SCOPe Domain Sequences for d2uxbn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2uxbn1:

Click to download the PDB-style file with coordinates for d2uxbn1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbn1: