Lineage for d2uxbg1 (2uxb G:2-156)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740240Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1740241Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1740242Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1740243Protein Ribosomal protein S7 [47975] (4 species)
  7. 1740273Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1740302Domain d2uxbg1: 2uxb G:2-156 [152268]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbr1, d2uxbs1, d2uxbt1, d2uxbu1
    automatically matched to d1fjgg_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxbg1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (G:) ribosomal protein s7

SCOPe Domain Sequences for d2uxbg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2uxbg1:

Click to download the PDB-style file with coordinates for d2uxbg1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbg1: