![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins) L and M are probably related to each other |
![]() | Protein L (light) subunit [81477] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries) Uniprot P02954 |
![]() | Domain d2ux5l1: 2ux5 L:1-281 [152256] Other proteins in same PDB: d2ux5m1 automatically matched to d1aigl_ complexed with bcl, bph, cdn, fe, gol, hto, lda, po4, spo, u10, uq2 |
PDB Entry: 2ux5 (more details), 2.21 Å
SCOP Domain Sequences for d2ux5l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux5l1 f.26.1.1 (L:1-281) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d2ux5l1: