SCOP 1.75: Domain d2ux4m1: 2ux4 M:1-303

Lineage for d2ux4m1 (2ux4 M:1-303)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
   Uniprot P02953

8. Domain d2ux4m1: 2ux4 M:1-303 [152255]
   Other proteins in same PDB: d2ux4l1
   automatically matched to d2rcrm_
   complexed with bcl, bph, cdn, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2ux4m1

PDB Entry: 2ux4, 2.51 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 9 in the charge-separated state, 2nd dataset

PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d2ux4m1:

Sequence; same for both SEQRES and ATOM records:

>d2ux4m1 f.26.1.1 (M:1-303) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

Timeline for d2ux4m1:

• d2ux4m1 is new in SCOP 1.75
  
• d2ux4m1 is called d2ux4m_ in SCOPe 2.01
  
• d2ux4m1 appears in the current release, SCOPe 2.08, called d2ux4m_