Lineage for d2ux3m1 (2ux3 M:1-303)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887887Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 887888Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 887889Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
    L and M are probably related to each other
  6. 887981Protein M (medium) subunit [81481] (3 species)
  7. 887982Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
    Uniprot P02953
  8. 888011Domain d2ux3m1: 2ux3 M:1-303 [152253]
    Other proteins in same PDB: d2ux3l1
    automatically matched to d2rcrm_
    complexed with bcl, bph, cdn, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2ux3m1

PDB Entry: 2ux3 (more details), 2.5 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 9 in the neutral state
PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d2ux3m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux3m1 f.26.1.1 (M:1-303) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

SCOP Domain Coordinates for d2ux3m1:

Click to download the PDB-style file with coordinates for d2ux3m1.
(The format of our PDB-style files is described here.)

Timeline for d2ux3m1: