Lineage for d2ux3m_ (2ux3 M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027525Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries)
  8. 3027566Domain d2ux3m_: 2ux3 M: [152253]
    Other proteins in same PDB: d2ux3h1, d2ux3h2
    automated match to d1ystm_
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2ux3m_

PDB Entry: 2ux3 (more details), 2.5 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 9 in the neutral state
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2ux3m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux3m_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

SCOPe Domain Coordinates for d2ux3m_:

Click to download the PDB-style file with coordinates for d2ux3m_.
(The format of our PDB-style files is described here.)

Timeline for d2ux3m_: