Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (5 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (31 PDB entries) |
Domain d2ux3l_: 2ux3 L: [152252] Other proteins in same PDB: d2ux3h1, d2ux3h2 automated match to d1aigl_ complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2 |
PDB Entry: 2ux3 (more details), 2.5 Å
SCOPe Domain Sequences for d2ux3l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux3l_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d2ux3l_: