| Class g: Small proteins [56992] (90 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
| Protein CD59 [57355] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57356] (6 PDB entries) |
| Domain d2ux2c_: 2ux2 C: [152251] automated match to d1cdqa_ |
PDB Entry: 2ux2 (more details), 1.8 Å
SCOPe Domain Sequences for d2ux2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux2c_ g.7.1.3 (C:) CD59 {Human (Homo sapiens) [TaxId: 9606]}
mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneqlen
Timeline for d2ux2c_: