![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein CD59 [57355] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57356] (11 PDB entries) |
![]() | Domain d2ux2c2: 2ux2 C:1-77 [152251] Other proteins in same PDB: d2ux2a3, d2ux2b3, d2ux2c3 automated match to d1cdqa_ |
PDB Entry: 2ux2 (more details), 1.8 Å
SCOPe Domain Sequences for d2ux2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux2c2 g.7.1.3 (C:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]} lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt yycckkdlcnfneqlen
Timeline for d2ux2c2:
![]() Domains from other chains: (mouse over for more information) d2ux2a2, d2ux2a3, d2ux2b2, d2ux2b3 |