SCOPe 2.01: Domain d2ux2b_: 2ux2 B:

Lineage for d2ux2b_ (2ux2 B:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)

6. Protein CD59 [57355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57356] (6 PDB entries)

8. Domain d2ux2b_: 2ux2 B: [152250]
   automated match to d1cdqa_

Details for d2ux2b_

PDB Entry: 2ux2, 1.8 Å

PDB Description: high resolution structure of human cd59

PDB Compounds: (B:) cd59 glycoprotein

SCOPe Domain Sequences for d2ux2b_:

Sequence; same for both SEQRES and ATOM records:

>d2ux2b_ g.7.1.3 (B:) CD59 {Human (Homo sapiens) [TaxId: 9606]}
mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneqlen

Timeline for d2ux2b_:

• d2ux2b_ first appeared in SCOP 1.75, called d2ux2b1
  
• d2ux2b_ appears in SCOPe 2.02
  
• d2ux2b_ appears in the current release, SCOPe 2.08, called d2ux2b2