SCOPe 2.08: Domain d2ux2b2: 2ux2 B:1-77

Lineage for d2ux2b2 (2ux2 B:1-77)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein CD59 [57355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57356] (11 PDB entries)

8. Domain d2ux2b2: 2ux2 B:1-77 [152250]
   Other proteins in same PDB: d2ux2a3, d2ux2b3, d2ux2c3
   automated match to d1cdqa_

Details for d2ux2b2

PDB Entry: 2ux2, 1.8 Å

PDB Description: high resolution structure of human cd59

PDB Compounds: (B:) cd59 glycoprotein

SCOPe Domain Sequences for d2ux2b2:

Sequence; same for both SEQRES and ATOM records:

>d2ux2b2 g.7.1.3 (B:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcnfneqlen

Timeline for d2ux2b2:

• d2ux2b2 first appeared in SCOP 1.75, called d2ux2b1
  
• d2ux2b2 was called d2ux2b_ in SCOPe 2.07