Lineage for d2ux2a1 (2ux2 A:1-77)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890414Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 890425Protein CD59 [57355] (1 species)
  7. 890426Species Human (Homo sapiens) [TaxId:9606] [57356] (8 PDB entries)
  8. 890429Domain d2ux2a1: 2ux2 A:1-77 [152249]
    automatically matched to d1cdqa_

Details for d2ux2a1

PDB Entry: 2ux2 (more details), 1.8 Å

PDB Description: high resolution structure of human cd59
PDB Compounds: (A:) cd59 glycoprotein

SCOP Domain Sequences for d2ux2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux2a1 g.7.1.3 (A:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcnfneqlen

SCOP Domain Coordinates for d2ux2a1:

Click to download the PDB-style file with coordinates for d2ux2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ux2a1: